10dB, 20db EDFA multicanal solo canal ganancia amplificador entrada óptico Edfa Raman de fibra Block

10dB, 20db EDFA multicanal solo canal ganancia amplificador entrada óptico Edfa Raman de fibra Block

Descripción de producto serie SP5100 es un amplificador óptico de CATV booster con la banda de espectro de ganancia en 1540 ~ 1565nm.

SP5100seriesisaCATVboosteropticalamplifierwithgainspectrumbandwithin1540 ~ 1565nm. Thiskindofopticalamplifierisdesignedfortheapplicationofsinglechannelor1~8continuousribbonchannels(ITUwavelength). Generally,fiberCATVsystemoperatesinsinglewavelengththathasnostrictrequirementongainflatness.HA5100 boosteramplifierisfeaturedwithlowNF, saturatedoutputpower alto. Itisapplicableforcentralbureau, sub-bureauandlinerelay, aswellasotheropticalcommunicationnetwork. HA5100isappliedmostcommonlyandwidelycomparedwithotheropticalamplifierinCATVsystem.
sopoisthefamousmanufacturerofopticalamplifier. HA5100opticalamplifieradoptstheworldand#39;stopclasspumplaserandAmericaOFSerbium-dopedopticalfiber.PerfectAPC,ACCandATCcontrol,excellentdesignintheventilationandheat-dissipationensurethelonglifeandhighreliableworkofpumplaser. RS232andRJ45offerserialcommutationandSNMPnetworkmanagementport.TheLCDatthefrontpanelofferstheworkindexofallequipmentandwarningalarm.Thelaserwillswitchoffautomaticallyifopticalpowerismissing,whichofferssecurityprotectionforthelaser. Alltheopticalportofopticalamplifiercanbeinstalledinthefrontpanel(alsocanbeinthebackpanelifcustomersspecify).
producto de sopo, foritshighquality, highreliableandhighcostperformance, istheidealchoiceofthesystemintegrationandsystemoperation.
1540 ~ 1563nmoperatingwavelength
Poco ruido, alta, highreliability
Threeexterioroption:1U(19"stander) 3D (12.4", 3U, escritorio-tipo) andmodulator
1Uand3Dexterior, offeringstatusappearanceanddiagnosingfaultwithLCD, standardRS232communicationinterface, SNMPnetworkmanagementfunction
DBSandamp; MMDS
255KmPAL-D/56CHandamp; 20CHDigitalQAMHybridTransmissionApplicationCases
TheapplicationofHA5100insatelliteL-Bandlong-distance(816Km) fibertransmission


Amplificador óptico de EDFA multicanal ganancia bloque está especialmente diseñado para cumplir con poco ruido y obtener requisitos de planitud de la

por sistema de división de longitud de onda densa. (Sistema de DWDM). Está disponible en varios tipos de clientes a elegir,

como amplificador booster, amplificador de línea y pre amplificador. Porque el amplificador óptico isTelcordia GR-1312-CORE cualificado y

RoHS obediente, clientes pueden sentirse seguros en comprarlo.


1. alta salida de potencia de gran fiabilidad

2. tamaño pequeño, fácil instalación

3. amplio rango de longitud de onda

SopofiberismultichannelopticalamplifiermanufacturerinChina, weoffermultichannelopticalamplifier, andopticalperformance

monitor,portablePONopticalpowermeter, wesupplyhighqualitywithcompetitiveprice, ourcompanyisbasedonChina,

puede completarse la cadena llena de manufacturingmini interruptor óptico, acoplador de la fibra de modo único árbol banda ancha en China, incluso en una ciudad.

Menor costo de fabricación ahorra su coste de compra. Más detalles de cada producto se muestran la página con la descripción.

Amplificador óptico Raman se diseña especialmente para el sistema de transmisión óptica de largo plazo.

Directamente pueden amplificar las señales ópticas de banda C, banda L y banda L C y mejorar

óptica relación señal a ruido (OSNR), mejorando así el rendimiento de transmisión del sistema.

El amplificador óptico puede actualizar el sistema existente a 10Gb/s o 40Gb/s. Además

es Telcordia GR-1312-CORE cualificado y RoHS obediente, dando a los clientes total tranquilidad.

1. estructura compacta, bajo consumo de energía
2. alta ganancia, buena llanura del aumento
3. alto rendimiento bomba láser y dispositivo pasivo

Sopofiber es fabricante de amplificador óptico Raman en China, ofrecemos amplificador óptico Raman,

y OEO convertidor, atenuador óptico variable portable, suministramos alta calidad con precio competitivo,

nuestra empresa se basa en China, de la cadena llena de atenuador óptico variable eléctrica, la fabricación

acoplador de banda ancha de la fibra monomodo puede realizarse en China, incluso en una ciudad.

Menor costo de fabricación ahorra su coste de compra.

Más detalles de cada producto se muestran la página con la descripción

Amplificador Óptico EDFA-MW/GW-VGA se diseña especialmente para el sistema de transmisión DWDM.

EDFA MW es módulo integrado optoelectrónicos y EDFA-GW es puro módulo óptico.

Sopofiber amplificador óptico es Telcordia GR-1312-CORE cualificado y RoHS obediente,

clientes pueden sentirse seguros en usarlo.

1. diseño de ganancia ajustable permite que el amplificador óptico flexible para una amplia variedad de condiciones de funcionamiento
2. etapa intermedia acceso para DCM, OADM
3. alta potencia, bajo ruido de salida
4. Apoye el modo ACC o AGC
5. estándar interfaz de comunicación RS232
6. exactitud de control alta, característica de buena respuesta transitoria
7. gran fiabilidad, bajo consumo de energía

Sopofiber es fabricante de amplificadores ópticos EDFA - VGA en China, ofrecemos el amplificador óptico EDFA - VGA,

y el módulo matriz del atenuador de MEMS, acoplador de la longitud de onda especial, suministramos alta calidad con precio competitivo,

nuestra empresa se basa en China, la cadena completa de fabricación convertidor de DWDM OEO, multicanal FBG DCM

módulo puede realizarse en China, incluso en una ciudad. Menor costo de fabricación ahorra su coste de compra.

Más detalles de cada producto se muestran la página con la descripción.

Amplificador Óptico EDFA-TV está especialmente diseñado y fabricado para el sistema de televisión por cable.Se instala detrás de la óptica

transmisor para aumentar la potencia de salida del transmisor yprolongar la distancia de transmisión de señal.

El amplificador óptico es Telcordia GR-1312-COREcalificado y RoHS aprobados.

1. alta potencia, bajo ruido de salida
2. todo el rango de longitud de onda, cubriendo toda la C-banda
3. gran confiabilidad
4. flexible interfaz de monitoreo
5. televisión por cable rack estándar fácil de instalar y mantener

Amplificador Óptico EDFA es adecuado para la red analógica de televisión por cable y red de distribución de fibra óptica.
Sopofiber es fabricante de amplificadores ópticos en China, ofrecemos amplificador óptico y atenuador óptico variable manual,

Divisor del PLC, suministramos alta calidad con precio competitivo, nuestra empresa se basa en China,

cadena completa de fabricación monitor de línea óptica, módulo de FBG DCM multicanal puede realizarse en China,

incluso en una ciudad. Menor costo de fabricación ahorra su coste de compra. Más detalles de cada producto

se muestra la página con la descripción.

Amplificador Óptico EDFA-PA es un amplificador de bajo ruido que está especialmente diseñado para el solo canal ópticosistema de transmisión.

Se instala antes el receptor para mejorar la sensibilidad del receptor y ampliar distancia de transmisión de la señal.

Como el amplificador óptico es Telcordia GR-1312-CORE cualificado y cumple con los requisitos RoHS,

los clientes pueden sentirse a gusto en su compra.

1. alta ganancia óptica, figura de poco ruido, buena función de inhibición de la ASE
2. alta confiabilidad, precio competitivo
3. flexible interfaz de monitoreo
4. amplio rango de longitud de onda
5. red de monitoreo disponibles
6. rack estándar de fácil instalación y mantenimiento

Amplificador Óptico EDFA-PA es ampliamente utilizado para red de área metropolitana, red de acceso,
red de larga distancia,

y varias clases de sistemas de transmisión SDH/PDH. Accelink es amplificador ópticofabricante en China,

Ofrecemos amplificador óptico y fijo atenuador de óptica,acoplador de la longitud de onda especial,Suministramos la alta calidad con

precio competitivo,nuestra empresa se basa en China,cadena completa de fabricación de módulo de FBG DCM solo canal,

línea óptica, protector de equipos puede realizarse en China, incluso en una ciudad. Fabricación bajoahorra costes

su coste de compra.Más detalles de cada producto se muestran la página con la descripción.

Amplificador Óptico EDFA-LA es un amplificador de línea especialmente diseñado para sistema de transmisión óptico de canal único.

Instalado en la línea de transmisión, el amplificador óptico puede compensar la pérdida de potencia óptica y prolongar la

distancia de transmisión de la señal. Esta es la opción ideal para el reemplazo regenerador O-E-O convencional.

Además, el amplificador óptico es Telcordia GR-1312-CORE cualificado y RoHS obediente, satisfacen tan sienten

seguro en comprarlo.

1 Amplificador Óptico EDFA-LA es más rentable y fiable que otros productos similares.
2. facilidad de uso, poco ruido
3. flexible interfaz de monitoreo
4. red de monitoreo disponibles
5. rack estándar, fácil de instalar y mantener

Amplificador óptico de Sopofiber es ideal para la red de larga distancia, red de área metropolitana, red de acceso,

así como varios sistemas de transmisión SDH/PDH.

Sopofiber es fabricante de amplificadores ópticos en China, ofrecemos amplificador óptico, interruptor óptico mini,

acoplador de la fibra de modo único árbol banda ancha, suministramos alta calidad con precio competitivo, nuestra empresa

se basa en China, la cadena completa de fabricación PD TAP, TAP PD matriz módulo, monitor de rendimiento óptico

puede realizarse en China, incluso en una ciudad. Menor costo de fabricación ahorra su coste de compra.

Más detalles de cada producto se muestran la página con la descripción

Amplificador Óptico EDFA-BA es un amplificador de refuerzo especialmente diseñado para el sistema de transmisión óptico de canal único.

Se instala detrás del transmisor óptico para aumentar la potencia de salida del transmisor y ampliar la señal

distancia de transmisión. El amplificador óptico es Telcordia GR-1312-CORE cualificado y cumple con los requisitos RoHS.

Debido a nuestro enfoque constante en la mejora del producto, Sopofiber el amplificador óptico tiene muchas ventajas, tales como
1. alta potencia, bajo ruido de salida
2. todo el rango de longitud de onda, cubriendo toda la C-banda
3. completa y flexible interfaz de monitoreo
4. independiente red control disponible
5. alta confiabilidad
6. rack estándar, fácil de instalar y mantener

Amplificador Óptico EDFA-BA es adecuado para la red de larga distancia, red de área metropolitana, red de acceso, así como varios sistemas de transmisión SDH/PDH.
Sopofiber es fabricante de amplificadores ópticos en China, ofrecemos amplificador óptico, interruptor óptico, acoplador de banda ancha fibra monomodo, suministramos alta calidad con precio competitivo, nuestra empresa se basa en China, cadena completa de fabricación PD coaxial, coaxial módulo de arreglo PD, medidor de potencia óptica multicanal puede realizarse en China, incluso en una ciudad. Menor costo de fabricación ahorra su coste de compra. Más detalles de cada producto se muestran la página con la descripción.

Amplificador Óptico EDFA solo canal ganancia módulo se diseña especialmente para el sistema de transmisión óptico de solo canal de banda C.

El amplificador óptico viene en varios tipos. EDFA-MD es el tipo general y EDFA-MC es el tipo compacto. El módulo puede

se utiliza para hacer tarjeta de EDFA o rack de montaje, según customerand #39; los requisitos específicos de s.

Sopofiber solo aumento módulo óptico amplificador es Telcordia GR-1312-CORE cualificado y RoHS obediente. Ya que es confiable,

fácil de instalar y viene con interfaz de control flexible, cada vez más se utiliza en la red de larga distancia, red de área metropolitana,

red de acceso, así como varios sistemas de transmisión SDH/PDH.

Sopofiber es fabricante de amplificadores ópticos en China, ofrecemos amplificador óptico y eléctrico atenuador óptico variable,

acoplador de banda ancha fibra monomodo, suministramos alta calidad con precio competitivo, nuestra empresa se basa en China,

completa cadena de fabricación convertidor OEO, módulo de fibra de compensación de dispersión puede ser completado en China,

incluso en una ciudad. Ahorra coste de fabricación menorsu coste de compra.

Más detalles de cada producto se muestran la página con la descripción.


thisproductcanbedividedintoboosteramplifier, lineamplifierandpreamplifier.

Yearsoffocusonproductimprovementhasresultedintheopticalamplifierhavingmanyadvantages, suchascompactstructure,

highoutputpower, lownoiseandgreatreliability. Asaresult, SopofiberopticalamplifierisTelcordiaGR1312CORE, RoHSqualified,



EDFAsinglechannelgainblockopticalamplifieriswidelyappliedinmetropolitanareanetwork, accessnetworkandCATVsystem,


SopofiberissinglechannelopticalamplifiermanufacturerinChina, weoffersinglechannelopticalamplifier, andmultichannelopticalpowermeter,opticalpowermeter,wesupplyhighqualitywithcompetitiveprice, ourcompanyisbasedonChina, fullchainofmanufacturingopticalswitch,

singlemodebroadbandfibercouplercanbecompletedinChina, eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.


Amplificador óptico del módulo de la ganancia de EDFA de banda L se diseña especialmente para cumplir con banda L DWDMand #39; s exigencias banda ancha,

de poco ruido, llanura del aumento y obtener el bloqueo. Incluye amplificador booster, amplificador de línea y pre amplificador. El módulo puede ser utilizado para

hacer tarjeta de EDFA o rack de montaje. Como el producto es Telcordia GR-1312-CORE cualificado y RoHS obediente, los clientes pueden sentirse

seguro en su compra.

Con las características de interfaz de control flexible, fácil instalación y tamaño compacto, EDFA de banda L ganancia amplificador óptico módulo

es ampliamente utilizado en sistema de transmisión óptica banda L y banda L DWDM.

Sopofiber es fabricante de amplificadores ópticos en China, ofrecemos amplificador óptico y protector de equipo de línea óptica, fuente de luz óptica,

Suministramos la alta calidad con precio competitivo, nuestra empresa se basa en China, la cadena completa de fabricación fijo atenuador de óptica,

acoplador de longitud de onda especial puede realizarse en China, incluso en una ciudad.

Menor costo de fabricación ahorra su coste de compra. Más detalles de cada producto se muestran la página con la descripción.

10 dBm de salida único canal Booster Amplificador Óptico EDFA de redes SDH
Amplificador de refuerzo SDH-EDFA-BA-O6 diseñado para las aplicaciones de la jerarquía Digital síncrona (SDH) que instala después el transmisor óptico para aumentar la distancia de transmisión para el sistema de módulo óptico de longitud de onda única. El dispositivo cuenta con rango de potencia de entrada de - 10 dBm a + 6dBm, potencia de salida hasta 10dBm y figura de poco ruido. También incluye interfaz de PC RS-232.

Este amplificador de montaje en Rack funcionan por defecto en modo constante de ganancia de señal, pero puede configurarse en modo de potencia de salida total constante. Estas unidades se utilizan en aplicaciones de transmisión de lances largos, especialmente para la PDH, SDH, SONET y solicitud de transmisión de Ethernet óptico. Su facilidad de uso y rendimiento hacen la serie SDH-EDFA-BA-xx la solución ideal para redes ópticas de acceso y Metro.

• El servicio como un amplificador booster 1550nm banda C
• Armonioso de potencia de salida: 10dBm
• Toda la gama de energía de entrada: -10 ~ + 6dBm
• Baja l figura: típico isandlt; 4,5 dB
• Conectores: existen conectores SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC y ST/APC
• Solo o dual 110VAC, 220VAC, 48VDC o 100V-240V fuente de alimentación
• Interfaz de serie viene con RS232, RS485
• 1U 19andquot; montaje de estructura para una fácil instalación
• Solicitar que todo rendimiento compatible con BellcoreGR-1312-CORE
• Uso de redes ópticas de acceso y Metro
• Funciona con aplicaciones de punto a punto
• Alta estabilidad y fiabilidad
• 3 años de garantía
• 10 años de vida de la operación
• OEM está disponible
Pone de relieve
Agente de administración de red • hot Swap
• SNMP network management interfaz: RJ45
• Soporte Telnet para opcional
• ASE ruido filtro YAMP; Filtros de supresión de ASE
• Circuito de alta precisa ACC (automatic constante actual) como por defecto, si usted necesita otro circuito, póngase en contacto con en sales@fiberstore.com
• Función de ATC (control automático de temperatura)
• Ofreciendo aspecto de condición y diagnóstico de fallas en LCD
Estructura mecánica

Ejemplo de estructura

El EDFA SDH de Fiberstore incluyendo 1 + 2 + 3.








Longitud de onda de operación






Potencia de salida saturada (1)




Energía de entrada (2)










Figura de ruido




Aislamiento de entrada




Aislamiento de salida




Bomba entrada salida




Salida de la bomba de salida





Pérdida de retorno




Aumento dependiente de la polarización








Temperatura de funcionamiento




Temperatura de almacenamiento




Humedad (3)




Voltaje de alimentación






Consumo de energía




Interfaz en serie

RS232, RS485

Fuente de alimentación

110 VCA, 220 VCA, - 48VDC o 100V-240V


Simplex SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC y ST/APC disponible


3 años

(1): cliente opcional
(2): amplificador de potencia: fuente de alimentación –35 ~-25dBm; Amplificador en línea: entrada de alimentación – 25 ~-10dBm, aumentador de presión: fuente de alimentación -10 ~ + 6dBm
(3): sin condensación

Ganancia 20dB monocanal EDFA de preamplificador amplificador óptico para redes SDH
SDH-EDFA-PA-g-20 amplificador de potencia diseñado para las aplicaciones de la jerarquía Digital síncrona (SDH) son monocanal EDFA que se instalan antes el receptor para mejorar la sensibilidad de recepción y ampliar distancia de transmisión de la señal. El dispositivo cuenta con gama de energía amplia entrada de - 35dBm a - 25dBm, 20dB de ganancia y bajo ruido. También incluye interfaz de PC RS-232.

Este amplificador de montaje en Rack funcionan por defecto en modo constante de ganancia de señal, pero puede configurarse en modo de potencia de salida total constante. Estas unidades se utilizan en aplicaciones de transmisión de lances largos, especialmente para la PDH, SDH, SONET y solicitud de transmisión de Ethernet óptico. Su facilidad de uso y rendimiento hacen la serie SDH-EDFA-PA-xx la solución ideal para redes ópticas de acceso y Metro.
• El servicio como un preamplificador banda C 1550nm
• Ganancia: 20dB
• Toda la gama de energía de entrada:-35dBm a - 25dBm
• Baja l figura: típico isandlt; 4,5 dB
• Conectores: existen conectores SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC y ST/APC
• Solo o dual 110VAC, 220VAC, 48VDC o 100V-240V fuente de alimentación
• Interfaz de serie viene con RS232, RS485
• 1U 19andquot; montaje de estructura para una fácil instalación
• Solicitar que todo rendimiento compatible con BellcoreGR-1312-CORE
• Uso de redes ópticas de acceso y Metro
• Funciona con aplicaciones de punto a punto
• Alta estabilidad y fiabilidad
• 3 años de garantía
• 10 años de vida de la operación
• OEM está disponible
Pone de relieve
Agente de administración de red • hot Swap
• SNMP network management interfaz: RJ45
• Soporte Telnet para opcional
• ASE ruido filtro YAMP; Filtros de supresión de ASE
• Circuito de alta precisa ACC (automatic constante actual) como por defecto, si usted necesita otro circuito, póngase en contacto con en sales@fiberstore.com
• Función de ATC (control automático de temperatura)
• Ofreciendo aspecto de condición y diagnóstico de fallas en LCD
Estructura mecánica

Ejemplo de estructura

El EDFA SDH de Fiberstore incluyendo 1 + 2 + 3.








Longitud de onda de operación






Potencia de salida saturada (1)




Energía de entrada (2)










Figura de ruido




Aislamiento de entrada




Aislamiento de salida




Bomba entrada salida




Salida de la bomba de salida





Pérdida de retorno




Aumento dependiente de la polarización








Temperatura de funcionamiento




Temperatura de almacenamiento




Humedad (3)




Voltaje de alimentación






Consumo de energía




Interfaz en serie

RS232, RS485

Fuente de alimentación

110 VCA, 220 VCA, - 48VDC o 100V-240V


Simplex SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC y ST/APC disponible


3 años

(1): cliente opcional
(2): amplificador de potencia: fuente de alimentación –35 ~-25dBm; Amplificador en línea: entrada de alimentación – 25 ~-10dBm, aumentador de presión: fuente de alimentación -10 ~ + 6dBm
(3): sin condensación



EDFA-MWisthegeneraltypeandEDFA-MCisthecompacttype.Accordingtocustomerand #39; srequirements, themodulecanbeused


Featuringsmallsize, poco ruido, easyinstallationandhighreliability, EDFAmulti-channelgainmoduleopticalamplifierisTelcordia

GR-1312-CORE, RoHSqualified, andisincreasinglyusedinDWDM, METROsystems.

SopofiberissinglechannelopticalamplifiermanufacturerinChina, weoffersinglechannelopticalamplifier, andMEMSvariable

opticalattenuator, monomodobroadbandtreefibercoupler, wesupplyhighqualitywithcompetitiveprice, ourcompanyisbased

onChina, fullchainofmanufacturingbidirectionalOEOconverter, singlechannelFBGDCMmodulecanbecompletedinChina,

eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.


Sopofiber de alta potencia amplificador óptico es un producto diseñado para aplicaciones de acceso óptico de FTTH/CATV.
Gracias al uso de Sopofiber Er-Yb revestido-bombeado había dopado Co tecnología de amplificador de fibra, su potencia total de salida puede ser hasta 33 dBm.

1 Wideoperatingwavelengthrange
2.Lownoise, convenientinstallationandmaintenance
3.Standard2Urackmount, multipleoutputlevels
4 Flexiblemonitoringinterface


SopofiberishighpoweropticalamplifiermanufacturerinChina, weofferhighpoweropticalamplifier, andbidirectionalOEO

convertidor,benchtopdigitalvariableopticalattenuator, wesupplyhighqualitywithcompetitiveprice,ourcompanyisbased

onChina, fullchainofmanufacturingMEMSvariableopticalattenuator, singlemodebroadbandtreefibercouplercanbe

completedinChina, eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.Themoredetailsofeachproduct


Aprovechando la amplia experiencia y conocimientos, SOPO es conocida como uno de los mayores fabricantes de 10db, 20db edfa multicanal solo canal ganancia bloque fibra edfa amplificador entrada óptico raman para su alta calidad y bajo precio de los productos y excelente servicio. Esté por favor libre al comprar productos baratos fabricados en China de nuestra fábrica.

Hot Tags: 10dB, 20db edfa multicanal solo canal ganancia bloque edfa de fibra óptico raman entrada fabricantes del amplificador, fábrica, hecho en China, calidad, precio, barato
productos relacionados
SOPO Optical Communication Co., Ltd

Dirección: JinDiDa Industry Zone, Pak Langkou industria, calle de Dalang, Longhua nuevo distrito, Shenzhen, China

Teléfono: +86-755-23124132

Fax: 86-755-23774378

Correo electrónico: 18818523155@163.com

SOPO Optical Communication Co., Ltd